PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_011096446.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Pedaliaceae; Sesamum
Family ARF
Protein Properties Length: 766aa    MW: 84401.7 Da    PI: 8.2047
Description ARF family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_011096446.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1B377.11.9e-24187288199
                     EEEE-..-HHHHTT-EE--HHH.HTT......---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSSE CS
              B3   1 ffkvltpsdvlksgrlvlpkkfaeeh......ggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgrse 89 
                     f+k+lt sd++++g +++p++ ae++      + +++ s++l+ +d++g +W++++iyr++++r++lt+GW+ Fv+ ++L +gD v+F +    +
  XP_011096446.1 187 FCKTLTASDTSTHGGFSVPRRAAEDCfppldyK-QQRPSQELVAKDLHGIEWKFRHIYRGQPRRHLLTTGWSAFVNKKKLVSGDAVLFLR--GGD 278
                     99****************************963.3445679************************************************3..378 PP

                     E..EEEEE-S CS
              B3  90 felvvkvfrk 99 
                     +el+++++r+
  XP_011096446.1 279 GELRLGIRRA 288
                     999***9986 PP

2Auxin_resp107.61.4e-35313394182
      Auxin_resp   1 aahaastksvFevvYnPrastseFvvkvekvekalkvkvsvGmRfkmafetedsserrlsGtvvgvsdldpvrWpnSkWrsL 82 
                     +++a+s++++F+++YnPra +se +v+++k++k+l +++s GmRfk++ etedsserr+sG+++gv+d+d  rWp+SkW++L
  XP_011096446.1 313 VVNAISMRTTFTICYNPRARSSEIIVPYHKFSKSLAHSFSCGMRFKIRCETEDSSERRCSGVIIGVTDVDRARWPGSKWKCL 394
                     6899*****************************************************************************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:2.40.330.104.6E-40184292IPR015300DNA-binding pseudobarrel domain
SuperFamilySSF1019362.22E-42184294IPR015300DNA-binding pseudobarrel domain
CDDcd100171.14E-22185287No hitNo description
SMARTSM010193.5E-24187289IPR003340B3 DNA binding domain
PROSITE profilePS5086313.408187289IPR003340B3 DNA binding domain
PfamPF023621.6E-22187288IPR003340B3 DNA binding domain
PfamPF065072.0E-31314394IPR010525Auxin response factor
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009725Biological Processresponse to hormone
GO:0010050Biological Processvegetative phase change
GO:0010158Biological Processabaxial cell fate specification
GO:0010582Biological Processfloral meristem determinacy
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 766 aa     Download sequence    Send to blast
MMCGLIDLNT VNNEEDTASL SGSPSSSSAS GNFEFAAASS TSVCMELWHA CAGPLISLPK  60
KGSAVVYFPQ GHVEHLPEHP AVAYDLPPHV FCRVVDVKLH VMISVFFFFL ILNGFVFVVL  120
VKVASFIGRG AQLVMRFMHK FHSFQINSSD SGNLDNIEQK WREGKIEAEL DDEDPDGIGK  180
AMTPHMFCKT LTASDTSTHG GFSVPRRAAE DCFPPLDYKQ QRPSQELVAK DLHGIEWKFR  240
HIYRGQPRRH LLTTGWSAFV NKKKLVSGDA VLFLRGGDGE LRLGIRRAAQ VQSGATVLPP  300
ASQQFNASTL AAVVNAISMR TTFTICYNPR ARSSEIIVPY HKFSKSLAHS FSCGMRFKIR  360
CETEDSSERR CSGVIIGVTD VDRARWPGSK WKCLMVRWDD MEVNRLNRVS PWEIEPSGSM  420
PGTNSFILPG TKRSRVGYPA AKLDLPVTRD GNEVSDFGEP LRFHKVLQGQ EVFGFSTPYA  480
GAEASRQHPS DMRCYPGVGG TRIRIGGNSF RHHQADARNS SEHAVLGESF QFHKVLQGQE  540
TASILSYGRG PEANQVQDKN AANVITGVKV PCHGNSWSTL TQVYNTNTHP SPSPPSALLL  600
QQSSSPPSQF TSLHYGNQNK LETCNMDSFC VPQRILKKHA SLDSSSMRED LQGLGSMGGL  660
DEHRHTAFPH LPVPTQPFFR DNQNLVSICK SSCRLFGFPL TEGKVTAGKG DNPAASASAY  720
AHETNVLPHN EEQLYQPPLM AKVIVSSCTK ASDMHVVRDR LLDIAL
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4ldy_A2e-794041916357Auxin response factor 1
4ldy_B2e-794041916357Auxin response factor 1
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00021PBMTransfer from AT2G33860Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKX0367241e-56KX036724.1 Salvia miltiorrhiza auxin response factor ARF4 (ARF) gene, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011096446.10.0PREDICTED: auxin response factor 3
SwissprotO236611e-178ARFC_ARATH; Auxin response factor 3
TrEMBLA0A022QL990.0A0A022QL99_ERYGU; Auxin response factor
STRINGPGSC0003DMT4000812820.0(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA61012333
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G33860.11e-177ARF family protein